PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s1059.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 188aa    MW: 21606 Da    PI: 8.8215
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s1059.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-202586157
                          TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          ++ R+++t eql++L +lF+   r+p+++++++++++l    +++ ++V++WFqN++a+e++
  Bostr.19424s1059.1.p 25 KCGRWNPTVEQLKILTDLFRAgLRTPTTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 86
                          568*****************99**************************************97 PP

2Wus_type_Homeobox114.17e-372588265
     Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                          ++ RW+Pt eQ+kiL++l+++GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
  Bostr.19424s1059.1.p 25 KCGRWNPTVEQLKILTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 88
                          678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6412287IPR001356Homeobox domain
SMARTSM003896.2E-42491IPR001356Homeobox domain
PfamPF000461.7E-172686IPR001356Homeobox domain
SuperFamilySSF466892.27E-112790IPR009057Homeodomain-like
CDDcd000869.27E-42888No hitNo description
Gene3DG3DSA:1.10.10.608.8E-82886IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSFSVKSRSL RSNSNGGGGG GTGTKCGRWN PTVEQLKILT DLFRAGLRTP TTDQIQKIST  60
ELSFYGKIES KNVFYWFQNH KARERQKRRK ISIDFDHHHH QPSTRDVFAI NEEDCQEEER  120
VIETLQLFPV NSFEDSNSKV EKMRARGNNN QYREYIRETN TTSFSPYSSC GAEMEQPSPL  180
DLRLSFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513980.0AY251398.1 Arabidopsis thaliana WOX5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187735.21e-124WUSCHEL-related homeobox 5
SwissprotQ8H1D21e-126WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLC0SVA61e-124C0SVA6_ARATH; Putative uncharacterized protein At3g11260 (Fragment)
STRINGAT3G11260.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-123WUSCHEL related homeobox 5